You have no items in your shopping cart.
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 17-200aa |
| Protein Length | Full Length of Mature Protein |
| MW | 22.8 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human CD16b/FCGR3B Protein, C-His [orb2966470]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
23.56 kDa
1 mg, 50 μg, 100 μgRecombinant Human CD16b Protein [orb2994740]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 48.8 KDa. Observed: 70 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human CD16b Protein [orb2994750]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 22.7 KDa. Observed: 35-65 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B), partial [orb2280236]
Greater than 95% as determined by SDS-PAGE.
20.8 kDa
Mammalian cell
1 mg, 100 μg, 20 μgCD16b/FCGR3B Rabbit Polyclonal Antibody [orb2955856]
ELISA, IHC, WB
Bacteria, Human, Monkey, Primate
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-B (FCGR3B) (orb2986658)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




