You have no items in your shopping cart.
Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84)
SKU: orb1649637
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Endotoxins | ess than 0.1 ng,μg (1 IEU,μg) as determined by LAL test |
| Purity | Greater than 95% as determined by reducing SDS-PAGE |
| Protein Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Storage & Handling
−| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
|---|---|
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human Parathyroid Hormone/Parathormone/PTH (1-84) (orb1649637)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review