Recombinant Human Platelet glycoprotein 4 (CD36)-VLPs, Fluorescent

SKU: orb2658783

Featured

Description

This Recombinant Human Platelet glycoprotein 4 (CD36)-VLPs, Fluorescent spans the amino acid sequence from region 1-472aa. Purity: The purity information is not available for VLPs proteins.

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Tag	C-terminal EGFP-tagged
Molecular Weight	79.9 kDa
Expression Region	1-472aa
Protein Length	Full Length
Protein Sequence	MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINLLGLIEMILLSVGVVMFVAFMISYCACRSKTIK
Purity	The purity information is not available for VLPs proteins.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Disclaimer	For research use only

Alternative Names

−

Fatty acid translocase;FAT;Glycoprotein IIIb;GPIIIB;Leukocyte differentiation antigen CD36;PAS IV;PAS-4;Platelet collagen receptor;Platelet glycoprotein IV;GPIV;Thrombospondin receptor;CD antigen CD36

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Recombinant Human Platelet glycoprotein 4 (CD36)-VLPs, Fluorescent

Detected by Mouse anti-GFP monoclonal antibody.

Quick Database Links

UniProt

P16671

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols