Recombinant Rabbit T-lymphocyte activation antigen CD80(CD80)

SKU: orb2902754

Description

This Recombinant Rabbit T-lymphocyte activation antigen CD80(CD80) spans the amino acid sequence from region 33-299.

Images & Validation

−

Key Properties

−

Biological Origin	Oryctolagus cuniculus (Rabbit)
Expression Region	33-299
Protein Length	full length protein
Protein Sequence	GISQVTKSVKEMAALSCDYNISIDELARMRIYWQKDQQMVLSIISGQVEVWPEYKNRTFPDIINNLSLMILALRLSDKGTYTCVVQKNENGSFRREHLTSVTLSIRADFPVPSITDIGHPDPNVKRIRCSASGGFPEPRLAWMEDGEELNAVNTTVDQDLDTELYSVSSELDFNVTNNHSIVCLIKYGELSVSQIFPWSKPKQEPPIDQLPFWVIIPVSGALVLTAVVLYCLACRHVARWKRTRRNEETVGTERLSPIYLGSAQSSG

Storage & Handling

−

Storage	Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Disclaimer	For research use only

Alternative Names

−

T-lymphocyte activation antigen CD80, Activation B7-1 antigen, CD_antigen= CD80

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P42070

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols