You have no items in your shopping cart.
Recombinant TNF alpha (Tumor necrosis factor alpha), Mouse, Animal-Free
SKU: orb1178921
Description
Research Area
Cancer Biology; Immunology & Inflammation
Images & Validation
−
| Tested Applications | Cell Culture, ELISA |
|---|
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Mouse |
| Biological Activity | Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <40 pg/mL. The specific activity of recombinant mouse TNF alpha is approximately >2.5x 107 IU/mg. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Protein Sequence | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYL DFAESGQVYFGVIAL with polyhistidine tag at the C-terminus. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−TNFSF2, Cachectin, Differentiation-inducing factor (DIF), Necrosin, Cytotoxin, TNS_x0002_F1A
Similar Products
−Recombinant TNF beta (Tumor necrosis factor beta), Mouse, Animal-Free [orb1178920]
Cell Culture, ELISA
>98% as determined by SDS-PAGE. Ni-NTA chromatography.
Escherichia coli
1 mg, 100 μg, 20 μg, 500 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Recombinant TNF alpha (Tumor necrosis factor alpha), Mouse, Animal-Free (orb1178921)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review