RecombinantIL-5Rα,Human

SKU: orb1494702

Description

Interleukin-5 Receptor Alpha (IL-5RA), also known as CD125, belongs to the Type 5 subfamily in the type I cytokine receptor family. It is composed of a ligand-specific alpha subunit and a signal-transducing beta subunit shared by the receptors for IL-3 and GM-CSF. IL-5RA is mainly expressed on eosinophils and basophils, and plays important roles in the immunobiology of these cell types. It is reported that when stimulated by IL-5, eosinophils down-regulate surface IL-5RA expression to attenuate their IL-5 responsiveness. Elevated IL-5 production may induce immune cell infiltration which leads to allergic inflammation. IL-5RA has also been reported to promote the differentiation of basophils and B cells.

Images & Validation

−

Application Notes	Reconstituted in ddH2O or PBS at 100 μg/ml.

Key Properties

−

Source	CHO
Biological Activity	ED50 < 0.2 ng/ml, measured in a cell proliferation assay using TF-1 cells in the presence of 1 ng/ml human IL-5.
Molecular Weight	53-56 kDa, observed by reducing SDS-PAGE.
Protein Sequence	DLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRT ILQNDHSLLASSWASAELHAPPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQINPPLNVTAEIEGTRLSIQWEK PVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDDLSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDE
Purification	> 95% as analyzed by SDS-PAGE and HPLC.
Purity	> 95% as analyzed by SDS-PAGE and HPLC.
Endotoxins	< 0.2 EU/μg, determined by LAL method.

Storage & Handling

−

Storage	Lyophilized recombinant Human Interleukin-5 Receptor Alpha remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Interleukin-5 Receptor Alpha should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Form/Appearance	Lyophilized after extensive dialysis against PBS.
Buffer/Preservatives	Lyophilized after extensive dialysis against PBS.
Disclaimer	For research use only

Alternative Names

−

IL-5RA, CD125

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols