Queen's Awards Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

S1PR1 Rabbit Polyclonal Antibody

SKU: orb331276

Description

Rabbit polyclonal antibody to S1PR1

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetS1PR1
Protein SequenceSynthetic peptide located within the following region: SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFIL
Molecular Weight43kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CHEDG1 antibody, anti D1S3362 antibody, anti ECGF1 antibody, anti EDG-1 antibody, anti EDG1 antibody, anti FLJ58121 antibody, anti S1P1 antibody

Similar Products

  • EDG1 Rabbit Polyclonal Antibody [orb100426]

    IF,  IHC-Fr,  IHC-P,  WB

    Canine, Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • S1PR1 Rabbit Polyclonal Antibody [orb385616]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • EDG-1 rabbit pAb Antibody [orb765097]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • EDG-1 rabbit pAb Antibody [orb767916]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • EDG-1 (phospho Thr236) rabbit pAb Antibody [orb767915]

    ELISA,  IF,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

S1PR1 Rabbit Polyclonal Antibody

Rabbit Anti-S1PR1 Antibody, Catalog Number: orb331276, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Plasma membrane, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

S1PR1 Rabbit Polyclonal Antibody

WB Suggested Anti-S1PR1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001391

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

S1PR1 Rabbit Polyclonal Antibody (orb331276)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry