STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

SKU: orb1981259

Description

This synthetic peptide, with the sequence STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, is derived from the angiotensin-converting enzyme 2 (ACE2) protein. It serves as a research tool for investigating ACE2's biochemical interactions and functions in both in vitro binding assays and cellular studies related to cardiovascular and pulmonary research.

Research Area

Metabolism Research

Images & Validation

−

Key Properties

−

Target	Angiotensin-converting Enzyme (ACE)
Molecular Weight	3649.88

Storage & Handling

−

Storage	-20°C
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

Angiotensin-converting Enzyme (ACE)

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols