Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

TAAR6 Rabbit Polyclonal Antibody

SKU: orb326537

Description

TAAR6 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of TAAR6. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6. This antibody reacts with Human, Monkey, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Monkey, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR6
TargetTAAR6
Protein SequenceSynthetic peptide located within the following region: YGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVA
Molecular Weight38kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti RP11-295F4.3 antibody, anti TA4 antibody, anti TAR4 antibody, anti TAR6 antibody, anti TRAR4 antibody

Similar Products

  • TAAR6 rabbit pAb Antibody [orb774518]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • TAAR6 Rabbit Polyclonal Antibody [orb1289984]

    FC,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • TAAR6 Rabbit Polyclonal Antibody [orb326538]

    WB

    Bovine, Equine, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • TAAR6 Rabbit Polyclonal Antibody [orb3071929]

    WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 30 μl, 50 μl
  • TAAR6 Rabbit Polyclonal Antibody (Fluoro594) [orb3096413]

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Fluoro594

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

TAAR6 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Ventral horn region of mouse spinal cord, Primary antibody Dilution: 1:200, Secondary antibody: Donkey anti-rabbit CY2, Secondary antibody Dilution: 1:500.

TAAR6 Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Rhesus macaque spinal cord, Primary antibody Dilution: 1:300, Secondary antibody: Donkey anti Rabbit 488, Secondary antibody Dilution: 1:500.

TAAR6 Rabbit Polyclonal Antibody

WB Suggested Anti-TAAR6 Antibody, Titration: 1.0 ug/mL, Positive Control: A549 Whole Cell.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_778237

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

TAAR6 Rabbit Polyclonal Antibody (orb326537)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry