TNF alpha Antibody

SKU: orb334996

Description

Goat polyclonal antibody to TNF alpha. TNF-α is produced by a variety of immune cells including NK cells, B cells, T cells and macrophages. It is multifunctional proinflammatory cytokine that belongs to the tumour necrosis factor (TNF) superfamily. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of several processes including lipid metabolism cell differentiation and proliferation, coagulation and apoptosis. It has been implicated in a variety of diseases, including cancer and autoimmune diseases.

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Dilution range	WB:1:500-1:2,000
Reactivity	Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes	The antibody solution should be gently mixed before use.

Key Properties

−

Antibody Type	Primary Antibody
Host	Goat
Clonality	Polyclonal
Isotype	IgG
Immunogen	Antigen: Purified recombinant human TNF-_ produced in E. coli.. Antigen Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Target	Tumor necrosis factor
Purification	Epitope affinity purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	PBS, 20% glycerol and 0.05% sodium azide
Concentration	1 mg/ml
Disclaimer	For research use only

Alternative Names

−

APC1, cachectin; tumor necrosis factor ligand superfamily member 2, macrophage-derived TNF, TNF-a, TNF monocyte-derived, tumor necrosis factor-alpha antibody.

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Western blot analysis of staining of total protein lysate using TNF alpha antibody

Quick Database Links

Gene Symbol

Tumor necrosis factor

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols