Human CD40 protein

SKU: orb594872

Featured

Active

Description

This Human CD40 protein spans the amino acid sequence from region 21-193aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

−

Item 1 of 1

Application Notes	Extracellular Domain

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	Measured by its binding ability in a functional ELISA. Immobilized Human CD40L-His-Flag at 10μg/ml can bind Human CD40-Fc, the ED50 of Human CD40-Fc is 0.45 ug/ml.
Tag	C-terminal Fc-tagged
Molecular Weight	46.3 kDa
Expression Region	21-193aa
Protein Length	Extracellular Domain
Protein Sequence	EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR
Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Disclaimer	For research use only

Alternative Names

−

Tumor Necrosis Factor Receptor Superfamily member 5; B-Cell Surface Antigen CD40; Bp50; CD40L Receptor; CDw40; CD40; TNFRSF5

Human CD40L [orb2994532]

Conjugation:	Unconjugated
Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
MW:	Predicted: 16.2 KDa. Observed: 16-18 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P25942

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols