You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation; Cell Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Loaded Anti-Human CD47 mAb-Fc on Protein A Biosensor, can bind Human CD47-His with an affinity constant of 0.22 nM as determined in BLI assay. |
| Tag | C-terminal 6xHis-tagged |
| Expression Region | 19-139aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 14.76 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Similar Products
−- Item 1 of 6
- Item 1 of 1
Human Integrin Associated Protein (IAP) ELISA Kit [orb777249]
Human
0.32-20 ng/mL
0.111 ng/mL
96 T, 48 T - Item 1 of 1
Human Integrin Associated Protein (IAP) ELISA Kit [orb1948686]
Human
0.16-10ng/mL
0.1 ng/mL
48 T, 96 T - Item 1 of 4
Recombinant Human CD47/MER6 Protein, C-His [orb2968053]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
16.68 kDa
1 mg, 50 μg, 100 μg - Item 1 of 4
CD47/MER6 Human Monoclonal Antibody [orb2977687]
ELISA, FA, FACS, In vivo
Human
Human Humanized
Monoclonal
Unconjugated
100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CD47 protein (orb594874)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks