You have no items in your shopping cart.
Human TGFBR1 Protein
SKU: orb1476940
Featured
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Molecular Weight | 17.6 kDa |
| Expression Region | 34-126aa |
| Protein Length | Partial |
| Protein Sequence | LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−(TGFR-1)(Activin A receptor type II-like protein kinase of 53kD)(Activin receptor-like kinase 5)(ALK-5)(ALK5)(Serine/threonine-protein kinase receptor R4)(SKR4)(TGF-beta type I receptor)(Transforming growth factor-beta receptor type I)(TGF-beta receptor type I)(TbetaR-I)
Similar Products
−- Item 1 of 1
Human Transforming Growth Factor Beta Receptor I (TGFbR1) ELISA Kit [orb775305]
Human
0.32-20 ng/mL
0.122 ng/mL
96 T, 48 T - Item 1 of 4
Human TGFBR1 Protein, N-hFc Tag [orb689441]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 36.3 kDa after removal of the signal peptide.The apparent molecular mass of hFc-TGFBR1 is approximately 40-53 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg - Item 1 of 3
- Item 1 of 2
TGFBR1 Antibody [orb675900]
ELISA, IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg - Item 1 of 1
Human TGFbR1(Transforming Growth Factor Beta Receptor I) Microsample ELISA Kit [orb2999024]
Human
0.32-20 ng/mL
0.119 ng/mL
48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human TGFBR1 Protein (orb1476940)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days