Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

IL1A Rabbit Polyclonal Antibody

SKU: orb333725

Description

IL1A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of IL1A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human IL1A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Goat, Mouse, Rat, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Immunology & Inflammation

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Goat, Mouse, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IL1A
TargetIL1A
Protein SequenceSynthetic peptide located within the following region: VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS
Molecular Weight31 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti Hematopoietin 1 antibody, anti Hematopoietin-1 antibody, anti IL 1 alpha antibody, anti IL 1 antibody, anti IL 1A antibody, anti IL-1 alpha antibody, anti Il-1a antibody, anti IL1 ALPHA antibody, anti IL1 antibody, anti IL1A antibody, anti IL1A_HUMAN antibody, anti IL1F1 antibody, anti ilia antibody, anti Interleukin 1 alpha antibody, anti Interleukin 1 alpha precursor antibody, anti Interleukin-1 alpha antibody, anti Interleukin1 alpha antibody, anti Preinterleukin 1 alpha antibody, anti Pro interleukin 1 alpha antibody

Similar Products

  • IL1 alpha Rabbit Polyclonal Antibody [orb308737]

    ELISA,  ICC,  IF,  IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • IL1A Antibody (Center) [orb1929753]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • IL-1 Alpha Rabbit Polyclonal Antibody [orb157678]

    FC,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IL-1 Alpha Propeptide Rabbit Polyclonal Antibody [orb184287]

    ELISA

    Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • IL1A Rabbit Polyclonal Antibody [orb627978]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

IL1A Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 2 ug/ml of the antibody was used in this experiment.

IL1A Rabbit Polyclonal Antibody

WB Suggested Anti-IL1A Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000566

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

IL1A Rabbit Polyclonal Antibody (orb333725)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry