You have no items in your shopping cart.
Recombinant Human T-cell-specific surface glycoprotein CD28(CD28)
Description
Research Area
Images & Validation
−
Key Properties
−| Biological Origin | Homo sapiens (Human) |
|---|---|
| Expression Region | 19-220 |
| Protein Length | full length protein |
| Protein Sequence | NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human /Cynomolgus CD28 Protein [orb2995095]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 16.7 KDa. Observed: 30-40 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human/Cynomolgus CD28 Protein (Biotin) [orb2993831]
Biotin
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 44.1 KDa. Observed: 60-90 KDa, reducing conditions
20 μg, 100 μgRecombinant Human /Cynomolgus CD28 Protein [orb2993961]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 42.3 KDa. Observed: 40-85 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human /Cynomolgus CD28 Protein [orb2994044]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 41.7 KDa. Observed: 40-75 KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μgRecombinant Mouse CD28 Protein [orb2994528]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 43 KDa. Observed: 60 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Human T-cell-specific surface glycoprotein CD28(CD28) (orb2902905)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review